FLJ25439 antibody (70R-3828)

Rabbit polyclonal FLJ25439 antibody raised against the N terminal Of Flj25439

Synonyms Polyclonal FLJ25439 antibody, Anti-FLJ25439 antibody, FLJ-25439, FLJ 25439, FLJ25439, Hypothetical Protein Flj25439 antibody, FLJ 25439 antibody, FLJ-25439 antibody
Specificity FLJ25439 antibody was raised against the N terminal Of Flj25439
Cross Reactivity Human
Applications WB
Immunogen FLJ25439 antibody was raised using the N terminal Of Flj25439 corresponding to a region with amino acids MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE
Assay Information FLJ25439 Blocking Peptide, catalog no. 33R-6319, is also available for use as a blocking control in assays to test for specificity of this FLJ25439 antibody

Images

Western Blot analysis using FLJ25439 antibody (70R-3828)

FLJ25439 antibody (70R-3828) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ25439 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FLJ25439 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FLJ25439 antibody (70R-3828) | FLJ25439 antibody (70R-3828) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors