FLJ25791 antibody (70R-3149)

Rabbit polyclonal FLJ25791 antibody raised against the middle region of Flj25791

Synonyms Polyclonal FLJ25791 antibody, Anti-FLJ25791 antibody, FLJ25791, FLJ 25791 antibody, MGC126763 antibody, FLJ 25791, FLJ-25791 antibody, Hypothetical Protein FLJ25791 antibody, FLJ-25791, MGC138153 antibody
Specificity FLJ25791 antibody was raised against the middle region of Flj25791
Cross Reactivity Human
Applications WB
Immunogen FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL
Assay Information FLJ25791 Blocking Peptide, catalog no. 33R-2831, is also available for use as a blocking control in assays to test for specificity of this FLJ25791 antibody


Western Blot analysis using FLJ25791 antibody (70R-3149)

FLJ25791 antibody (70R-3149) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ25791 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FLJ25791 is believed to be involved in nucleotide kinase activity and nucleotide binding

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLJ25791 antibody (70R-3149) | FLJ25791 antibody (70R-3149) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors