FLJ33790 antibody (70R-3788)

Rabbit polyclonal FLJ33790 antibody raised against the N terminal of FLJ33790

Synonyms Polyclonal FLJ33790 antibody, Anti-FLJ33790 antibody, FLJ-33790 antibody, FLJ-33790, FLJ 33790, FLJ33790, FLJ 33790 antibody, Hypothetical Protein Flj33790 antibody
Specificity FLJ33790 antibody was raised against the N terminal of FLJ33790
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FLJ33790 antibody was raised using the N terminal of FLJ33790 corresponding to a region with amino acids RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR
Assay Information FLJ33790 Blocking Peptide, catalog no. 33R-8105, is also available for use as a blocking control in assays to test for specificity of this FLJ33790 antibody

Images

Western Blot analysis using FLJ33790 antibody (70R-3788)

FLJ33790 antibody (70R-3788) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ33790 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FLJ33790 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FLJ33790 antibody (70R-3788) | FLJ33790 antibody (70R-3788) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors