FLJ35767 antibody (70R-4288)

Rabbit polyclonal FLJ35767 antibody raised against the middle region of FLJ35767

Synonyms Polyclonal FLJ35767 antibody, Anti-FLJ35767 antibody, FLJ-35767 antibody, Hypothetical Protein Flj35767 antibody, FLJ 35767, FLJ 35767 antibody, FLJ35767, FLJ-35767
Specificity FLJ35767 antibody was raised against the middle region of FLJ35767
Cross Reactivity Human
Applications WB
Immunogen FLJ35767 antibody was raised using the middle region of FLJ35767 corresponding to a region with amino acids PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS
Assay Information FLJ35767 Blocking Peptide, catalog no. 33R-7042, is also available for use as a blocking control in assays to test for specificity of this FLJ35767 antibody


Western Blot analysis using FLJ35767 antibody (70R-4288)

FLJ35767 antibody (70R-4288) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ35767 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FLJ35767 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLJ35767 antibody (70R-4288) | FLJ35767 antibody (70R-4288) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors