FLJ35848 antibody (70R-3427)

Rabbit polyclonal FLJ35848 antibody raised against the C terminal of FLJ35848

Synonyms Polyclonal FLJ35848 antibody, Anti-FLJ35848 antibody, FLJ 35848 antibody, MGC43301 antibody, FLJ35848, Hypothetical Protein Flj35848 antibody, FLJ 35848, FLJ-35848, FLJ-35848 antibody
Specificity FLJ35848 antibody was raised against the C terminal of FLJ35848
Cross Reactivity Human
Applications WB
Immunogen FLJ35848 antibody was raised using the C terminal of FLJ35848 corresponding to a region with amino acids LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP
Assay Information FLJ35848 Blocking Peptide, catalog no. 33R-5015, is also available for use as a blocking control in assays to test for specificity of this FLJ35848 antibody


Western Blot analysis using FLJ35848 antibody (70R-3427)

FLJ35848 antibody (70R-3427) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ35848 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FLJ35848 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLJ35848 antibody (70R-3427) | FLJ35848 antibody (70R-3427) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors