FLJ37543 antibody (70R-3454)

Rabbit polyclonal FLJ37543 antibody raised against the middle region of FLJ37543

Synonyms Polyclonal FLJ37543 antibody, Anti-FLJ37543 antibody, FLJ-37543 antibody, FLJ 37543 antibody, MGC138213 antibody, FLJ-37543, MGC138187 antibody, FLJ 37543, FLJ37543, Hypothetical Protein Flj37543 antibody
Specificity FLJ37543 antibody was raised against the middle region of FLJ37543
Cross Reactivity Human
Applications WB
Immunogen FLJ37543 antibody was raised using the middle region of FLJ37543 corresponding to a region with amino acids PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS
Assay Information FLJ37543 Blocking Peptide, catalog no. 33R-6988, is also available for use as a blocking control in assays to test for specificity of this FLJ37543 antibody


Western Blot analysis using FLJ37543 antibody (70R-3454)

FLJ37543 antibody (70R-3454) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ37543 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FLJ37543 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLJ37543 antibody (70R-3454) | FLJ37543 antibody (70R-3454) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors