FLJ40504 antibody (70R-4263)

Rabbit polyclonal FLJ40504 antibody raised against the N terminal of FLJ40504

Synonyms Polyclonal FLJ40504 antibody, Anti-FLJ40504 antibody, FLJ-40504 antibody, FLJ-40504, Hypothetical Protein Flj40504 antibody, FLJ 40504 antibody, MGC138231 antibody, FLJ 40504, FLJ40504, MGC138233 antibody
Specificity FLJ40504 antibody was raised against the N terminal of FLJ40504
Cross Reactivity Human
Applications WB
Immunogen FLJ40504 antibody was raised using the N terminal of FLJ40504 corresponding to a region with amino acids MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL
Assay Information FLJ40504 Blocking Peptide, catalog no. 33R-5837, is also available for use as a blocking control in assays to test for specificity of this FLJ40504 antibody

Images

Western Blot analysis using FLJ40504 antibody (70R-4263)

FLJ40504 antibody (70R-4263) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ40504 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FFLJ40504 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FLJ40504 antibody (70R-4263) | FLJ40504 antibody (70R-4263) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors