FMO3 antibody (70R-6582)

Rabbit polyclonal FMO3 antibody raised against the N terminal of FMO3

Synonyms Polyclonal FMO3 antibody, Anti-FMO3 antibody, Flavin Containing Monooxygenase 3 antibody, dJ127D3.1 antibody, FMOII antibody, MGC34400 antibody
Specificity FMO3 antibody was raised against the N terminal of FMO3
Cross Reactivity Human
Applications WB
Immunogen FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE
Assay Information FMO3 Blocking Peptide, catalog no. 33R-2997, is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody

Images

Western Blot analysis using FMO3 antibody (70R-6582)

FMO3 antibody (70R-6582) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FMO3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FMO3 antibody (70R-6582) | FMO3 antibody (70R-6582) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors