FMO4 antibody (70R-6252)

Rabbit polyclonal FMO4 antibody raised against the N terminal of FMO4

Synonyms Polyclonal FMO4 antibody, Anti-FMO4 antibody, Flavin Containing Monooxygenase 4 antibody, FMOIV antibody, FMO2 antibody
Specificity FMO4 antibody was raised against the N terminal of FMO4
Cross Reactivity Human
Applications WB
Immunogen FMO4 antibody was raised using the N terminal of FMO4 corresponding to a region with amino acids MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG
Assay Information FMO4 Blocking Peptide, catalog no. 33R-6578, is also available for use as a blocking control in assays to test for specificity of this FMO4 antibody

Images

Western Blot analysis using FMO4 antibody (70R-6252)

FMO4 antibody (70R-6252) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FMO4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FMO4 antibody (70R-6252) | FMO4 antibody (70R-6252) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors