FNDC4 antibody (70R-6597)

Rabbit polyclonal FNDC4 antibody raised against the middle region of FNDC4

Synonyms Polyclonal FNDC4 antibody, Anti-FNDC4 antibody, Fibronectin Type Iii Domain Containing 4 antibody, FLJ22362 antibody, FRCP1 antibody
Specificity FNDC4 antibody was raised against the middle region of FNDC4
Cross Reactivity Human, Mouse
Applications WB
Immunogen FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS
Assay Information FNDC4 Blocking Peptide, catalog no. 33R-2440, is also available for use as a blocking control in assays to test for specificity of this FNDC4 antibody


Western Blot analysis using FNDC4 antibody (70R-6597)

FNDC4 antibody (70R-6597) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FNDC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Fibronectin protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FNDC4 antibody (70R-6597) | FNDC4 antibody (70R-6597) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors