FOLH1 antibody (70R-7150)

Rabbit polyclonal FOLH1 antibody

Synonyms Polyclonal FOLH1 antibody, Anti-FOLH1 antibody, mGCP antibody, PSMA antibody, FGCP antibody, GCPII antibody, NAALAD1 antibody, PSM antibody, FOLH antibody, NAALAdase antibody, Folate Hydrolase antibody, Prostate-Specific Membrane Antigen 1 antibody, GCP2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA
Assay Information FOLH1 Blocking Peptide, catalog no. 33R-3141, is also available for use as a blocking control in assays to test for specificity of this FOLH1 antibody

Images

Western Blot analysis using FOLH1 antibody (70R-7150)

FOLH1 antibody (70R-7150) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FOLH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FOLH1 is a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FOLH1 antibody (70R-7150) | FOLH1 antibody (70R-7150) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors