FOLR1 antibody (70R-7209)

Rabbit polyclonal FOLR1 antibody

Synonyms Polyclonal FOLR1 antibody, Anti-FOLR1 antibody, MOv18 antibody, Folate Receptor 1 antibody, FBP antibody, FR-alpha antibody, FOLR antibody, Folate Receptor antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FOLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF
Assay Information FOLR1 Blocking Peptide, catalog no. 33R-3731, is also available for use as a blocking control in assays to test for specificity of this FOLR1 antibody


Western blot analysis using FOLR1 antibody (70R-7209)

Recommended FOLR1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FOLR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using FOLR1 antibody (70R-7209) | Recommended FOLR1 Antibody Titration: 0.2-1 ug/ml
  • Immunofluorescent staining using FOLR1 antibody (70R-7209) | FOLR1 antibody staining of Formalin Fixed Paraffin Embedded Human Lung Tissue. Observed Staining: Membrane and cytoplasmic in alveolar
  • Western blot analysis using FOLR1 antibody (70R-7209) | Tissue analyzed: PANC1 Whole Cell Lane A: Primary Antibody Lane B:Primary Antibody + Blocking Peptide. Primary Antibody Concentration:1ug/ml; Peptide Concentration: 5ug/ml Lysate Quantity: 25ug/lane/Lane Gel Concentration: 0.12

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors