FOXRED1 antibody (70R-4893)

Rabbit polyclonal FOXRED1 antibody raised against the N terminal of FOXRED1

Synonyms Polyclonal FOXRED1 antibody, Anti-FOXRED1 antibody, H17 antibody, FOXRED 1, Fad-Dependent Oxidoreductase Domain Containing 1 antibody, FP634 antibody, FOXRED 1 antibody, FOXRED-1 antibody, FOXRED1, FOXRED-1
Specificity FOXRED1 antibody was raised against the N terminal of FOXRED1
Cross Reactivity Human
Applications WB
Immunogen FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK
Assay Information FOXRED1 Blocking Peptide, catalog no. 33R-8389, is also available for use as a blocking control in assays to test for specificity of this FOXRED1 antibody

Images

Western Blot analysis using FOXRED1 antibody (70R-4893)

FOXRED1 antibody (70R-4893) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FOXRED1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The FOXRED1 protein contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FOXRED1 antibody (70R-4893) | FOXRED1 antibody (70R-4893) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors