FSIP1 antibody (70R-3397)

Rabbit polyclonal FSIP1 antibody raised against the middle region of FSIP1

Synonyms Polyclonal FSIP1 antibody, Anti-FSIP1 antibody, FSIP1, Fibrous Sheath Interacting Protein 1 antibody, FSIP-1 antibody, FSIP-1, FLJ35989 antibody, FSIP 1, HSD10 antibody, FSIP 1 antibody
Specificity FSIP1 antibody was raised against the middle region of FSIP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT
Assay Information FSIP1 Blocking Peptide, catalog no. 33R-1906, is also available for use as a blocking control in assays to test for specificity of this FSIP1 antibody

Images

Western Blot analysis using FSIP1 antibody (70R-3397)

FSIP1 antibody (70R-3397) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FSIP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FSIP1 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FSIP1 antibody (70R-3397) | FSIP1 antibody (70R-3397) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors