FTHL17 antibody (70R-6380)

Rabbit polyclonal FTHL17 antibody raised against the middle region of FTHL17

Synonyms Polyclonal FTHL17 antibody, Anti-FTHL17 antibody, Ferritin Heavy Polypeptide-Like 17 antibody
Specificity FTHL17 antibody was raised against the middle region of FTHL17
Cross Reactivity Human
Applications WB
Immunogen FTHL17 antibody was raised using the middle region of FTHL17 corresponding to a region with amino acids FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE
Assay Information FTHL17 Blocking Peptide, catalog no. 33R-2958, is also available for use as a blocking control in assays to test for specificity of this FTHL17 antibody

Images

Western Blot analysis using FTHL17 antibody (70R-6380)

FTHL17 antibody (70R-6380) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FTHL17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FTHL17 antibody (70R-6380) | FTHL17 antibody (70R-6380) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors