FTHL17 antibody (70R-6913)

Rabbit polyclonal FTHL17 antibody raised against the N terminal of FTHL17

Synonyms Polyclonal FTHL17 antibody, Anti-FTHL17 antibody, Ferritin Heavy Polypeptide-Like 17 antibody
Specificity FTHL17 antibody was raised against the N terminal of FTHL17
Cross Reactivity Human
Applications WB
Immunogen FTHL17 antibody was raised using the N terminal of FTHL17 corresponding to a region with amino acids MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR
Assay Information FTHL17 Blocking Peptide, catalog no. 33R-5656, is also available for use as a blocking control in assays to test for specificity of this FTHL17 antibody


Western Blot analysis using FTHL17 antibody (70R-6913)

FTHL17 antibody (70R-6913) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FTHL17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FTHL17 antibody (70R-6913) | FTHL17 antibody (70R-6913) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors