FTO antibody (70R-4523)

Rabbit polyclonal FTO antibody raised against the middle region of FTO

Synonyms Polyclonal FTO antibody, Anti-FTO antibody, KIAA1752 antibody, MGC5149 antibody, Fat Mass And Obesity Associated antibody
Specificity FTO antibody was raised against the middle region of FTO
Cross Reactivity Human
Applications WB
Immunogen FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA
Assay Information FTO Blocking Peptide, catalog no. 33R-10037, is also available for use as a blocking control in assays to test for specificity of this FTO antibody


Western Blot analysis using FTO antibody (70R-4523)

FTO antibody (70R-4523) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FTO antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The exact function of this gene is not known. Studies in mice suggest that it may be involved in nucleic acid demethylation, and that its mRNA level is regulated by feeding and fasting. Genomewide association studies of type 2 diabetes indicate this gene as a diabetes susceptibility locus. Mutation in this gene has been associated with growth retardation, developmental delay, coarse facies, and early death.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FTO antibody (70R-4523) | FTO antibody (70R-4523) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors