FTSJ1 antibody (70R-2060)

Rabbit polyclonal FTSJ1 antibody

Synonyms Polyclonal FTSJ1 antibody, Anti-FTSJ1 antibody, CDLIV antibody, JM23 antibody, SPB1 antibody, MRX9 antibody, MRX44 antibody, Ftsj Homolog 1 antibody, TRM7 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FTSJ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA
Assay Information FTSJ1 Blocking Peptide, catalog no. 33R-6070, is also available for use as a blocking control in assays to test for specificity of this FTSJ1 antibody


Western Blot analysis using FTSJ1 antibody (70R-2060)

FTSJ1 antibody (70R-2060) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FTSJ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FTSJ1 is a member of the S-adenosylmethionine-binding protein family. It is a nucleolar protein and may be involved in the processing and modification of rRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FTSJ1 antibody (70R-2060) | FTSJ1 antibody (70R-2060) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors