FUCA1 antibody (70R-5286)

Rabbit polyclonal FUCA1 antibody raised against the N terminal of FUCA1

Synonyms Polyclonal FUCA1 antibody, Anti-FUCA1 antibody, Fucosidase Alpha-L- 1 Tissue antibody
Specificity FUCA1 antibody was raised against the N terminal of FUCA1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FUCA1 antibody was raised using the N terminal of FUCA1 corresponding to a region with amino acids PSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLL
Assay Information FUCA1 Blocking Peptide, catalog no. 33R-7363, is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody

Images

Western Blot analysis using FUCA1 antibody (70R-5286)

FUCA1 antibody (70R-5286) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FUCA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man: that in tissues, FUCA1, which is deficient in fucosidosis, and that in plasma, FUCA2. Fucosidosis is an autosomal recessive lysosomal storage disease caused by defective alpha-L-fucosidase with accumulation of fucose in the tissues. Different phenotypes include clinical features such as neurologic deterioration, growth retardation, visceromegaly, and seizures in a severe early form; coarse facial features, angiokeratoma corporis diffusum, spasticity and delayed psychomotor development in a longer surviving form; and an unusual spondylometaphyseoepiphyseal dysplasia in yet another form.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FUCA1 antibody (70R-5286) | FUCA1 antibody (70R-5286) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors