FUNDC1 antibody (70R-3680)

Rabbit polyclonal FUNDC1 antibody raised against the N terminal of FUNDC1

Synonyms Polyclonal FUNDC1 antibody, Anti-FUNDC1 antibody, Fun14 Domain Containing 1 antibody, MGC51029 antibody
Specificity FUNDC1 antibody was raised against the N terminal of FUNDC1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen FUNDC1 antibody was raised using the N terminal of FUNDC1 corresponding to a region with amino acids MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
Assay Information FUNDC1 Blocking Peptide, catalog no. 33R-5789, is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody

Images

Western Blot analysis using FUNDC1 antibody (70R-3680)

FUNDC1 antibody (70R-3680) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FUNDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FUNDC1 antibody (70R-3680) | FUNDC1 antibody (70R-3680) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors