FURIN antibody (70R-6735)

Rabbit polyclonal FURIN antibody

Synonyms Polyclonal FURIN antibody, Anti-FURIN antibody, SPC1 antibody, PACE antibody, PCSK3 antibody, Furin antibody, FUR antibody, Paired Basic Amino Acid Cleaving Enzyme antibody
Cross Reactivity Human
Applications WB
Immunogen FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI
Assay Information FURIN Blocking Peptide, catalog no. 33R-7864, is also available for use as a blocking control in assays to test for specificity of this FURIN antibody

Images

Western Blot analysis using FURIN antibody (70R-6735)

FURIN antibody (70R-6735) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FURIN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FURIN antibody (70R-6735) | FURIN antibody (70R-6735) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors