FUSIP1 antibody (70R-4858)

Rabbit polyclonal FUSIP1 antibody

Synonyms Polyclonal FUSIP1 antibody, Anti-FUSIP1 antibody, SFRS13 antibody, TASR1 antibody, Fus Interacting Protein antibody, TASR2 antibody, TASR antibody, FUSIP2 antibody, NSSR antibody, SRp38 antibody, Serine/Arginine-Rich 1 antibody, SRrp40 antibody
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen FUSIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSS
Assay Information FUSIP1 Blocking Peptide, catalog no. 33R-9019, is also available for use as a blocking control in assays to test for specificity of this FUSIP1 antibody

Images

Immunohistochemical staining using FUSIP1 antibody (70R-4858)

FUSIP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FUSIP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using FUSIP1 antibody (70R-4858) | FUSIP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using FUSIP1 antibody (70R-4858) | FUSIP1 antibody (70R-4858) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors