FUT1 antibody (70R-4516)

Rabbit polyclonal FUT1 antibody

Synonyms Polyclonal FUT1 antibody, Anti-FUT1 antibody, HSC antibody, H antibody, HH antibody, Galactoside 2-Alpha-L-Fucosyltransferase H Blood Group antibody, Fucosyltransferase 1 antibody
Cross Reactivity Human
Applications WB
Immunogen FUT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL
Assay Information FUT1 Blocking Peptide, catalog no. 33R-2285, is also available for use as a blocking control in assays to test for specificity of this FUT1 antibody

Images

Western Blot analysis using FUT1 antibody (70R-4516)

FUT1 antibody (70R-4516) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FUT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FUT1 antibody (70R-4516) | FUT1 antibody (70R-4516) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors