FXR1 antibody (70R-5038)

Rabbit polyclonal FXR1 antibody raised against the C terminal of FXR1

Synonyms Polyclonal FXR1 antibody, Anti-FXR1 antibody, Fragile X Mental Retardation Autosomal Homolog 1 antibody
Specificity FXR1 antibody was raised against the C terminal of FXR1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW
Assay Information FXR1 Blocking Peptide, catalog no. 33R-2671, is also available for use as a blocking control in assays to test for specificity of this FXR1 antibody

Images

Western Blot analysis using FXR1 antibody (70R-5038)

FXR1 antibody (70R-5038) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FXR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FXR1 is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FXR1 antibody (70R-5038) | FXR1 antibody (70R-5038) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors