FXYD5 antibody (70R-6056)

Rabbit polyclonal FXYD5 antibody raised against the middle region of FXYD5

Synonyms Polyclonal FXYD5 antibody, Anti-FXYD5 antibody, Fsxyd5, OIT2 antibody, Fsxyd 5, IWU-1 antibody, Fsxyd-5 antibody, Fsxyd-5, RIC antibody, dysad antibody, Fsxyd 5 antibody, PRO6241 antibody, IWU1 antibody, Fxyd Domain Containing Ion Transport Regulator 5 antibody, KCT1 antibody, HSPC113 antibody
Specificity FXYD5 antibody was raised against the middle region of FXYD5
Cross Reactivity Human
Applications WB
Immunogen FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG
Assay Information FXYD5 Blocking Peptide, catalog no. 33R-8401, is also available for use as a blocking control in assays to test for specificity of this FXYD5 antibody

Images

Western Blot analysis using FXYD5 antibody (70R-6056)

FXYD5 antibody (70R-6056) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FXYD5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FXYD5 antibody (70R-6056) | FXYD5 antibody (70R-6056) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors