FZD10 antibody (70R-7226)

Rabbit polyclonal FZD10 antibody

Synonyms Polyclonal FZD10 antibody, Anti-FZD10 antibody, FzE7 antibody, hFz10 antibody, Frizzled Homolog 10 antibody, FZ-10 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF
Assay Information FZD10 Blocking Peptide, catalog no. 33R-7152, is also available for use as a blocking control in assays to test for specificity of this FZD10 antibody

Images

Western Blot analysis using FZD10 antibody (70R-7226)

FZD10 antibody (70R-7226) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FZD10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FZD10 antibody (70R-7226) | FZD10 antibody (70R-7226) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors