FZD4 antibody (70R-7474)

Rabbit polyclonal FZD4 antibody

Synonyms Polyclonal FZD4 antibody, Anti-FZD4 antibody, MGC34390 antibody, EVR1 antibody, Fz-4 antibody, FZD4S antibody, FzE4 antibody, FEVR antibody, Frizzled Homolog 4 antibody, GPCR antibody, Frizzled family receptor 4, FEVR antibody, WNT receptor frizzled-4 antibody, CD344 antibody
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
Assay Information FZD4 Blocking Peptide, catalog no. 33R-3346, is also available for use as a blocking control in assays to test for specificity of this FZD4 antibody

Images

Immunohistochemical staining using FZD4 antibody (70R-7474)

Immunohistochemical staining of human skin cells using 70R-7474

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FZD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using FZD4 antibody (70R-7474) | Immunohistochemical staining of human skin cells using 70R-7474

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors