FZD6 antibody (70R-7308)

Rabbit polyclonal FZD6 antibody

Synonyms Polyclonal FZD6 antibody, Anti-FZD6 antibody, Frizzled Homolog 6 antibody, Hfz6 antibody
Cross Reactivity Human
Applications WB
Immunogen FZD6 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE
Assay Information FZD6 Blocking Peptide, catalog no. 33R-3764, is also available for use as a blocking control in assays to test for specificity of this FZD6 antibody


Western Blot analysis using FZD6 antibody (70R-7308)

FZD6 antibody (70R-7308) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FZD6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FZD6 antibody (70R-7308) | FZD6 antibody (70R-7308) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors