FZR1 antibody (70R-4472)

Rabbit polyclonal FZR1 antibody

Synonyms Polyclonal FZR1 antibody, Anti-FZR1 antibody, HCDH antibody, FZR2 antibody, KIAA1242 antibody, FZR antibody, CDH1 antibody, Fizzy/Cell Division Cycle 20 Related 1 antibody, CDC20C antibody, HCDH1 antibody
Cross Reactivity Human
Applications WB
Immunogen FZR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
Assay Information FZR1 Blocking Peptide, catalog no. 33R-8839, is also available for use as a blocking control in assays to test for specificity of this FZR1 antibody


Western Blot analysis using FZR1 antibody (70R-4472)

FZR1 antibody (70R-4472) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FZR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FZR1 antibody (70R-4472) | FZR1 antibody (70R-4472) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors