G22P1 antibody (70R-1051)

Rabbit polyclonal G22P1 antibody raised against the N terminal Of G22P1

Synonyms Polyclonal G22P1 antibody, Anti-G22P1 antibody, GP1-22 antibody, GP1 22, G22P1, GP1 22 antibody, GP1-22, ATP dependent DNA helicase 2 subunit 1
Specificity G22P1 antibody was raised against the N terminal Of G22P1
Cross Reactivity Human
Applications IHC, WB
Immunogen G22P1 antibody was raised using the N terminal Of G22P1 corresponding to a region with amino acids NFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVL
Assay Information G22P1 Blocking Peptide, catalog no. 33R-6687, is also available for use as a blocking control in assays to test for specificity of this G22P1 antibody


Immunohistochemical staining using G22P1 antibody (70R-1051)

G22P1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes arrows) in Human Liver. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of G22P1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.6 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using G22P1 antibody (70R-1051) | G22P1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes arrows) in Human Liver. Magnification is at 400X.
  • Western Blot analysis using G22P1 antibody (70R-1051) | G22P1 antibody (70R-1051) used at 0.6 ug/ml to detect target protein.
  • Immunohistochemical staining using G22P1 antibody (70R-1051) | G22P1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors