G3BP antibody (70R-1654)

Rabbit polyclonal G3BP antibody raised against the N terminal Of G3Bp

Synonyms Polyclonal G3BP antibody, Anti-G3BP antibody, GAP SH3 domain binding protein 1 antibody, Ras GTPase activating protein SH3 domain binding protein antibody, GBP-3, GBP-3 antibody, RasGAP associated endoribonuclease G3BP antibody , GAP binding protein antibody, Ras GTPase activating protein binding protein 1 antibody, ATP dependent DNA helicase VIII antibody, GC111040 antibody, G3BP antibody, HDH VIII antibody, G3BP1 antibody, GBP 3 antibody, G3BP, GBP 3
Specificity G3BP antibody was raised against the N terminal Of G3Bp
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen G3BP antibody was raised using the N terminal Of G3Bp corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
Assay Information G3BP Blocking Peptide, catalog no. 33R-2785, is also available for use as a blocking control in assays to test for specificity of this G3BP antibody

Images

Western blot analysis using G3BP antibody (70R-1654)

Recommended G3BP Antibody Titration: 2.5ug/ml

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of G3BP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using G3BP antibody (70R-1654) | Recommended G3BP Antibody Titration: 2.5ug/ml
  • Western blot analysis using G3BP antibody (70R-1654) | G3BP antibody Western Blot & Peptide Block Validation

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors