G3BP1 antibody (70R-5892)

Rabbit polyclonal G3BP1 antibody

Synonyms Polyclonal G3BP1 antibody, Anti-G3BP1 antibody, Ras GTPase activating protein SH3 domain binding protein antibody, G3BP, G3BP antibody, GBP 3, G3BP antibody, Sh3 Domain Binding Protein 1 antibody, G3BP antibody, ATP dependent DNA helicase VIII antibody, MGC111040 antibody, GAP binding protein antibody, HDH-VIII antibody, GC111040 antibody, GBP-3 antibody, Ras GTPase activating protein binding protein 1 antibody, GBP-3, HDH VIII antibody, GBP 3 antibody, RasGAP associated endoribonuclease G3BP antibody , GAP SH3 domain binding protein 1 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen G3BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
Assay Information G3BP1 Blocking Peptide, catalog no. 33R-7905, is also available for use as a blocking control in assays to test for specificity of this G3BP1 antibody

Images

Western Blot analysis using G3BP1 antibody (70R-5892)

G3BP1 antibody (70R-5892) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of G3BP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using G3BP1 antibody (70R-5892) | G3BP1 antibody (70R-5892) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors