G6PC antibody (70R-6258)

Rabbit polyclonal G6PC antibody raised against the N terminal of G6PC

Synonyms Polyclonal G6PC antibody, Anti-G6PC antibody, GPC 6, GPC-6 antibody, G6PT antibody, GSD1a antibody, Glucose-6-Phosphatase Catalytic Subunit antibody, G6PC, GPC 6 antibody, GPC-6, MGC163350 antibody
Specificity G6PC antibody was raised against the N terminal of G6PC
Cross Reactivity Human,Dog
Applications WB
Immunogen G6PC antibody was raised using the N terminal of G6PC corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
Assay Information G6PC Blocking Peptide, catalog no. 33R-6784, is also available for use as a blocking control in assays to test for specificity of this G6PC antibody

Images

Immunohistochemical staining using G6PC antibody (70R-6258)

G6PC antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of G6PC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using G6PC antibody (70R-6258) | G6PC antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using G6PC antibody (70R-6258) | G6PC antibody (70R-6258) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors