GABARAPL2 antibody (70R-3393)

Rabbit polyclonal GABARAPL2 antibody

Synonyms Polyclonal GABARAPL2 antibody, Anti-GABARAPL2 antibody, Gaba A receptor-associated protein like 2 antibody, GEF2 antibody, GEF-2 antibody, GATE16 antibody, GATE-16 antibody, ATG8 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV
Assay Information GABARAPL2 Blocking Peptide, catalog no. 33R-4731, is also available for use as a blocking control in assays to test for specificity of this GABARAPL2 antibody

Images

Western Blot analysis using GABARAPL2 antibody (70R-3393)

GABARAPL2 antibody (70R-3393) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABARAPL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GABARAPL2 antibody (70R-3393) | GABARAPL2 antibody (70R-3393) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors