GABRA5 antibody (70R-5218)

Rabbit polyclonal GABRA5 antibody

Synonyms Polyclonal GABRA5 antibody, Anti-GABRA5 antibody, Gaba A Receptor Alpha 5 antibody, Gamma-Aminobutyric Acid antibody, MGC138184 antibody
Cross Reactivity Human
Applications WB
Immunogen GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSE
Assay Information GABRA5 Blocking Peptide, catalog no. 33R-1296, is also available for use as a blocking control in assays to test for specificity of this GABRA5 antibody

Images

Western Blot analysis using GABRA5 antibody (70R-5218)

GABRA5 antibody (70R-5218) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GABRA5 antibody (70R-5218) | GABRA5 antibody (70R-5218) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors