GABRB2 antibody (70R-5191)

Rabbit polyclonal GABRB2 antibody

Synonyms Polyclonal GABRB2 antibody, Anti-GABRB2 antibody, Gaba A Receptor Beta 2 antibody, Gamma-Aminobutyric Acid antibody, MGC119389 antibody, MGC119386 antibody, MGC119388 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTT
Assay Information GABRB2 Blocking Peptide, catalog no. 33R-2088, is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody


Western Blot analysis using GABRB2 antibody (70R-5191)

GABRB2 antibody (70R-5191) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GABRB2 antibody (70R-5191) | GABRB2 antibody (70R-5191) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors