GABRB3 antibody (70R-5196)

Rabbit polyclonal GABRB3 antibody

Synonyms Polyclonal GABRB3 antibody, Anti-GABRB3 antibody, Gamma-Aminobutyric Acid antibody, Gaba A Receptor Beta 3 antibody, MGC9051 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GABRB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA
Assay Information GABRB3 Blocking Peptide, catalog no. 33R-2752, is also available for use as a blocking control in assays to test for specificity of this GABRB3 antibody

Images

Western Blot analysis using GABRB3 antibody (70R-5196)

GABRB3 antibody (70R-5196) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABRB3 is a member of the ligand-gated ionic channel family. GABRB3 is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GABRB3 antibody (70R-5196) | GABRB3 antibody (70R-5196) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors