GABRE antibody (70R-5193)

Rabbit polyclonal GABRE antibody

Synonyms Polyclonal GABRE antibody, Anti-GABRE antibody, Gamma-Aminobutyric Acid antibody, Gaba A Receptor Epsilon antibody
Cross Reactivity Human
Applications WB
Immunogen GABRE antibody was raised using a synthetic peptide corresponding to a region with amino acids KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV
Assay Information GABRE Blocking Peptide, catalog no. 33R-4574, is also available for use as a blocking control in assays to test for specificity of this GABRE antibody


Western Blot analysis using GABRE antibody (70R-5193)

GABRE antibody (70R-5193) used at 2 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABRE belongs to the ligand-gated ionic channel family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants encoding different isoforms have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GABRE antibody (70R-5193) | GABRE antibody (70R-5193) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors