GABRR1 antibody (70R-5215)

Rabbit polyclonal GABRR1 antibody

Synonyms Polyclonal GABRR1 antibody, Anti-GABRR1 antibody, MGC163216 antibody, Gaba Receptor Rho 1 antibody, Gamma-Aminobutyric Acid antibody
Cross Reactivity Human
Applications WB
Immunogen GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH
Assay Information GABRR1 Blocking Peptide, catalog no. 33R-6181, is also available for use as a blocking control in assays to test for specificity of this GABRR1 antibody


Western Blot analysis using GABRR1 antibody (70R-5215)

GABRR1 antibody (70R-5215) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GABRR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GABRR1 antibody (70R-5215) | GABRR1 antibody (70R-5215) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors