GAD1 antibody (70R-4463)

Rabbit polyclonal GAD1 antibody

Synonyms Polyclonal GAD1 antibody, Anti-GAD1 antibody, GAD 1, FLJ45882 antibody, GAD antibody, GAD1, SCP antibody, GAD-1, GAD 1 antibody, Glutamate Decarboxylase 1 antibody, GAD-1 antibody
Cross Reactivity Human
Applications WB
Immunogen GAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF
Assay Information GAD1 Blocking Peptide, catalog no. 33R-5764, is also available for use as a blocking control in assays to test for specificity of this GAD1 antibody

Images

Western Blot analysis using GAD1 antibody (70R-4463)

GAD1 antibody (70R-4463) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GAD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67 kDa form and a less-frequent 25 kDa form.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GAD1 antibody (70R-4463) | GAD1 antibody (70R-4463) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors