GADD45B antibody (70R-5930)

Rabbit polyclonal GADD45B antibody raised against the middle region of GADD45B

Synonyms Polyclonal GADD45B antibody, Anti-GADD45B antibody, Growth Arrest And Dna-Damage-Inducible Beta antibody, GADD45BETA antibody, DKFZP566B133 antibody, MYD118 antibody
Specificity GADD45B antibody was raised against the middle region of GADD45B
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen GADD45B antibody was raised using the middle region of GADD45B corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
Assay Information GADD45B Blocking Peptide, catalog no. 33R-2851, is also available for use as a blocking control in assays to test for specificity of this GADD45B antibody

Images

Western Blot analysis using GADD45B antibody (70R-5930)

GADD45B antibody (70R-5930) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GADD45B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GADD45B antibody (70R-5930) | GADD45B antibody (70R-5930) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors