GADL1 antibody (70R-4286)

Rabbit polyclonal GADL1 antibody raised against the middle region of GADL1

Synonyms Polyclonal GADL1 antibody, Anti-GADL1 antibody, GADL 1, Glutamate Decarboxylase-Like 1 antibody, GADL 1 antibody, GADL-1 antibody, GADL1, MGC138191 antibody, GADL-1
Specificity GADL1 antibody was raised against the middle region of GADL1
Cross Reactivity Human
Applications WB
Immunogen GADL1 antibody was raised using the middle region of GADL1 corresponding to a region with amino acids SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA
Assay Information GADL1 Blocking Peptide, catalog no. 33R-8292, is also available for use as a blocking control in assays to test for specificity of this GADL1 antibody

Images

Western Blot analysis using GADL1 antibody (70R-4286)

GADL1 antibody (70R-4286) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GADL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of GADL1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GADL1 antibody (70R-4286) | GADL1 antibody (70R-4286) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors