GALM antibody (70R-4149)

Rabbit polyclonal GALM antibody

Synonyms Polyclonal GALM antibody, Anti-GALM antibody, Galactose Mutarotase antibody, Aldose 1-Eimerase antibody, BLOCK 25 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK
Assay Information GALM Blocking Peptide, catalog no. 33R-9947, is also available for use as a blocking control in assays to test for specificity of this GALM antibody

Images

Western Blot analysis using GALM antibody (70R-4149)

GALM antibody (70R-4149) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALM is an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. It is expressed in the cytoplasm and has a preference for galactose. The protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GALM antibody (70R-4149) | GALM antibody (70R-4149) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors