GALNAC4S-6ST antibody (70R-5944)

Rabbit polyclonal GALNAC4S-6ST antibody raised against the middle region of GALNAC4S-6ST

Synonyms Polyclonal GALNAC4S-6ST antibody, Anti-GALNAC4S-6ST antibody, DKFZp781H1369 antibody, GALNACS-4 antibody, BRAG antibody, GALNACS 4 antibody, MGC34346 antibody, GALNAC4S, GALNACS-4, KIAA0598 antibody, RP11-47G11.1 antibody, B Cell Rag Associated Protein antibody, GALNACS 4
Specificity GALNAC4S-6ST antibody was raised against the middle region of GALNAC4S-6ST
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALNAC4S-6ST antibody was raised using the middle region of GALNAC4S-6ST corresponding to a region with amino acids YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
Assay Information GALNAC4S-6ST Blocking Peptide, catalog no. 33R-10074, is also available for use as a blocking control in assays to test for specificity of this GALNAC4S-6ST antibody

Images

Western Blot analysis using GALNAC4S-6ST antibody (70R-5944)

GALNAC4S-6ST antibody (70R-5944) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALNAC4S-6ST antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GALNAC4S-6ST antibody (70R-5944) | GALNAC4S-6ST antibody (70R-5944) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors