GALNT13 antibody (70R-7449)

Rabbit polyclonal GALNT13 antibody raised against the N terminal Of Galnt13

Synonyms Polyclonal GALNT13 antibody, Anti-GALNT13 antibody, MGC119461 antibody, H_NH0187G20.1 antibody, KIAA1918 antibody, WUGSC:H_NH0187G20.1 antibody, MGC119459 antibody, GalNAc-T13 antibody, FLJ41157 antibody, FLJ16031 antibody
Specificity GALNT13 antibody was raised against the N terminal Of Galnt13
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALNT13 antibody was raised using the N terminal Of Galnt13 corresponding to a region with amino acids CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI
Assay Information GALNT13 Blocking Peptide, catalog no. 33R-1754, is also available for use as a blocking control in assays to test for specificity of this GALNT13 antibody

Images

Western Blot analysis using GALNT13 antibody (70R-7449)

GALNT13 antibody (70R-7449) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALNT13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GALNT13 antibody (70R-7449) | GALNT13 antibody (70R-7449) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors