GALNT14 antibody (70R-7437)

Rabbit polyclonal GALNT14 antibody

Synonyms Polyclonal GALNT14 antibody, Anti-GALNT14 antibody, FLJ12691 antibody, FLJ13977 antibody, Galnac-T14 antibody, Udp-N-Acetyl-Alpha-D-Galactosamine:Polypeptide N-Acetylgalactosaminyltransferase 14 antibody, GALNT15 antibody, GalNac-T14 antibody, GalNac-T10 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALNT14 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA
Assay Information GALNT14 Blocking Peptide, catalog no. 33R-4908, is also available for use as a blocking control in assays to test for specificity of this GALNT14 antibody

Images

Western Blot analysis using GALNT14 antibody (70R-7437)

GALNT14 antibody (70R-7437) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALNT14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GALNT14 antibody (70R-7437) | GALNT14 antibody (70R-7437) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors