GALNT4 antibody (70R-7248)

Rabbit polyclonal GALNT4 antibody

Synonyms Polyclonal GALNT4 antibody, Anti-GALNT4 antibody, GALNAC-T4 antibody, Galnac-T4 antibody, Udp-N-Acetyl-Alpha-D-Galactosamine:Polypeptide N-Acetylgalactosaminyltransferase 4 antibody, GalNAcT4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDI
Assay Information GALNT4 Blocking Peptide, catalog no. 33R-9559, is also available for use as a blocking control in assays to test for specificity of this GALNT4 antibody

Images

Western Blot analysis using GALNT4 antibody (70R-7248)

GALNT4 antibody (70R-7248) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALNT4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALNT4 is a member of the UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GALNT4 antibody (70R-7248) | GALNT4 antibody (70R-7248) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors