GALNT5 antibody (70R-7239)

Rabbit polyclonal GALNT5 antibody

Synonyms Polyclonal GALNT5 antibody, Anti-GALNT5 antibody, MGC165041 antibody, GALNAC-T5 antibody, Galnac-T5 antibody, Udp-N-Acetyl-Alpha-D-Galactosamine:Polypeptide N-Acetylgalactosaminyltransferase 5 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE
Assay Information GALNT5 Blocking Peptide, catalog no. 33R-2573, is also available for use as a blocking control in assays to test for specificity of this GALNT5 antibody

Images

Western Blot analysis using GALNT5 antibody (70R-7239)

GALNT5 antibody (70R-7239) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 106 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALNT5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALNT5 can catalyze the initial reaction in O-linked oligosaccharide biosynthesis,the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. GALNT5 has activity toward EA2 peptide substrate, but it has a weak activity toward Muc2 or Muc1b substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GALNT5 antibody (70R-7239) | GALNT5 antibody (70R-7239) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors