GALNT6 antibody (70R-7465)

Rabbit polyclonal GALNT6 antibody

Synonyms Polyclonal GALNT6 antibody, Anti-GALNT6 antibody, Galnac-T6 antibody, Udp-N-Acetyl-Alpha-D-Galactosamine:Polypeptide N-Acetylgalactosaminyltransferase 6 antibody, GALNAC-T6 antibody, GalNAcT6 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN
Assay Information GALNT6 Blocking Peptide, catalog no. 33R-2472, is also available for use as a blocking control in assays to test for specificity of this GALNT6 antibody


Western Blot analysis using GALNT6 antibody (70R-7465)

GALNT6 antibody (70R-7465) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALNT6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GALNT6 antibody (70R-7465) | GALNT6 antibody (70R-7465) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors