GALNTL1 antibody (70R-6899)

Rabbit polyclonal GALNTL1 antibody raised against the N terminal Of Galntl1

Synonyms Polyclonal GALNTL1 antibody, Anti-GALNTL1 antibody, MGC141855 antibody, KIAA1130 antibody, GALNT16 antibody
Specificity GALNTL1 antibody was raised against the N terminal Of Galntl1
Cross Reactivity Human,Rat
Applications WB
Immunogen GALNTL1 antibody was raised using the N terminal Of Galntl1 corresponding to a region with amino acids LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP
Assay Information GALNTL1 Blocking Peptide, catalog no. 33R-5407, is also available for use as a blocking control in assays to test for specificity of this GALNTL1 antibody

Images

Western Blot analysis using GALNTL1 antibody (70R-6899)

GALNTL1 antibody (70R-6899) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GALNTL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GALNTL1 belongs to the glycosyltransferase 2 family, GalNAc-T subfamily. It contains 1 ricin B-type lectin domain. GALNTL1 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GALNTL1 antibody (70R-6899) | GALNTL1 antibody (70R-6899) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors